Lineage for d2h29a_ (2h29 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) 
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species) 
Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries) 
Domain d2h29a_: 2h29 A: [164920]
automated match to d1kama_
complexed with dnd
Details for d2h29a_
PDB Entry: 2h29 (more details), 2 Å
PDB Description: Crystal structure of Nicotinic acid mononucleotide Adenylyltransferase from Staphylococcus aureus: product bound form 1
PDB Compounds: (A:) Probable nicotinate-nucleotide adenylyltransferaseSCOPe Domain Sequences for d2h29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h29a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]}
mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
ikgeglye
SCOPe Domain Coordinates for d2h29a_:
Click to download the PDB-style file with coordinates for d2h29a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h29a_:
- d2h29a_ first appeared in SCOPe 2.01
- d2h29a_ appears in SCOPe 2.06
- d2h29a_ appears in the current release, SCOPe 2.08
View in 3D
