Lineage for d2h1ia1 (2h1i A:1-202)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151618Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2151623Protein Carboxylesterase [53548] (2 species)
  7. 2151624Species Bacillus cereus [TaxId:1396] [159737] (1 PDB entry)
    Uniprot Q81AD5 1-202
    similar fold and function to the Pseudomonas fluorescens enzyme despite low sequence identity
  8. 2151625Domain d2h1ia1: 2h1i A:1-202 [147210]
    Other proteins in same PDB: d2h1ia2, d2h1ib3, d2h1ic3
    complexed with ca, cl, zn

Details for d2h1ia1

PDB Entry: 2h1i (more details), 2.8 Å

PDB Description: Crystal Structure of the Bacillus cereus Carboxylesterase
PDB Compounds: (A:) carboxylesterase

SCOPe Domain Sequences for d2h1ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}
mmkhvfqkgkdtskpvllllhgtggneldllplaeivdseasvlsvrgnvlengmprffr
rlaegifdeedlifrtkelnefldeaakeykfdrnnivaigysnganiaasllfhyenal
kgavlhhpmvprrgmqlanlagksvfiaagtndpicssaeseelkvllenananvtmhwe
nrghqltmgevekakewydkaf

SCOPe Domain Coordinates for d2h1ia1:

Click to download the PDB-style file with coordinates for d2h1ia1.
(The format of our PDB-style files is described here.)

Timeline for d2h1ia1: