Lineage for d2h0fb_ (2h0f B:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common foldSuperfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) 
Family b.3.4.0: automated matches [191441] (1 protein)
not a true familyProtein automated matches [190651] (8 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [193190] (3 PDB entries) 
Domain d2h0fb_: 2h0f B: [193191]
automated match to d2g2nc_
complexed with aza
Details for d2h0fb_
PDB Entry: 2h0f (more details), 2.7 Å
PDB Description: crystal structure of pucm in the presence of 8-azaxanthine
PDB Compounds: (B:) Transthyretin-like protein pucMSCOPe Domain Sequences for d2h0fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0fb_ b.3.4.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs
SCOPe Domain Coordinates for d2h0fb_:
Click to download the PDB-style file with coordinates for d2h0fb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2h0fb_:
- d2h0fb_ first appeared in SCOPe 2.02
- d2h0fb_ appears in SCOPe 2.06
- d2h0fb_ appears in the current release, SCOPe 2.08
View in 3D
