Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [230757] (1 PDB entry) |
Domain d2h0aa_: 2h0a A: [230758] automated match to d3tb6b_ |
PDB Entry: 2h0a (more details), 2.8 Å
SCOPe Domain Sequences for d2h0aa_:
Sequence, based on SEQRES records: (download)
>d2h0aa_ c.93.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]} tvsvllpfvatefyrrlvegiegvlleqrydlalfpilslarlkrylenttlayltdgli lasydlterfeegrlpterpvvlvdaqnprydsvyldnrlggrlagaylarfpgpifaia veeepdrafrrtvfaermagfqealkeagrpfspdrlyitrhsqeggrlalrhflekasp plnvfagadqvalgvleeavrlgltpgrdvrvlgfdghpfaeeaglstiaqpveamgara aqlllermrgyqgpprevrfepvlverastgtppaa
>d2h0aa_ c.93.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]} tvsvllpfvatefyrrlvegiegvlleqrydlalfpilslarlkyltdglilasydltrl pterpvvlvdaqnprydsvyldnrlggrlagaylarfpgpifaiaveeepdrrtvfaerm agfqealkeagrpfspdrlyitrhsqeggrlalrhflekaspplnvfagadqvalgvlee avrlgltpgrdvrvlgfdghpfaeeaglstiaqpveamgaraaqlllermrgyqgpprev rfepvlverastgtppaa
Timeline for d2h0aa_: