Lineage for d2gwfe1 (2gwf E:181-315)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368162Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 1368163Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 1368251Family c.46.1.4: Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117586] (1 protein)
    automatically mapped to Pfam PF00581
  6. 1368252Protein Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117587] (1 species)
  7. 1368253Species Human (Homo sapiens) [TaxId:9606] [117588] (2 PDB entries)
    Uniprot P40818 174-317
  8. 1368256Domain d2gwfe1: 2gwf E:181-315 [135804]
    Other proteins in same PDB: d2gwfb1, d2gwfd_, d2gwff_
    automatically matched to d1whba_

Details for d2gwfe1

PDB Entry: 2gwf (more details), 2.3 Å

PDB Description: Structure of a USP8-NRDP1 complex
PDB Compounds: (E:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d2gwfe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwfe1 c.46.1.4 (E:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}
gaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeaispgvtaswieahlp
ddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwesktvlrneplvlegg
yenwllcypqyttna

SCOPe Domain Coordinates for d2gwfe1:

Click to download the PDB-style file with coordinates for d2gwfe1.
(The format of our PDB-style files is described here.)

Timeline for d2gwfe1: