Lineage for d2gvha1 (2gvh A:9-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943623Protein Probable acyl-CoA hydrolase AGR_L_2016 [143148] (1 species)
  7. 2943624Species Agrobacterium tumefaciens [TaxId:358] [143149] (1 PDB entry)
    Uniprot Q7CTE6 147-262! Uniprot Q7CTE6 9-143
  8. 2943625Domain d2gvha1: 2gvh A:9-143 [135776]
    complexed with na

Details for d2gvha1

PDB Entry: 2gvh (more details), 2.5 Å

PDB Description: crystal structure of acyl-coa hydrolase (15159470) from agrobacterium tumefaciens at 2.65 a resolution
PDB Compounds: (A:) AGR_L_2016p

SCOPe Domain Sequences for d2gvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]}
kpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtascerid
frqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipegeda
asyvlpellteetpd

SCOPe Domain Coordinates for d2gvha1:

Click to download the PDB-style file with coordinates for d2gvha1.
(The format of our PDB-style files is described here.)

Timeline for d2gvha1:

2943625
d2gvha1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2gvha2