Lineage for d2guya1 (2guy A:382-476)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Fungal alpha-amylase [51028] (2 species) Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (8 PDB entries) 
Domain d2guya1: 2guy A:382-476 [135754]
Other proteins in same PDB: d2guya2
automated match to d7taaa1
complexed with ca
Details for d2guya1
PDB Entry: 2guy (more details), 1.59 Å
PDB Description: orthorhombic crystal structure (space group p21212) of aspergillus niger alpha-amylase at 1.6 a resolution
PDB Compounds: (A:) alpha-amylase ASCOPe Domain Sequences for d2guya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2guya1 b.71.1.1 (A:382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase [TaxId: 5062]}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics
SCOPe Domain Coordinates for d2guya1:
Click to download the PDB-style file with coordinates for d2guya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2guya1:
- d2guya1 first appeared in SCOP 1.73
- d2guya1 appears in SCOPe 2.07
View in 3D
