Lineage for d2gupa1 (2gup A:1-114)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.10: ROK [110636] (8 proteins)
Pfam PF00480
Protein Hypothetical protein SP2142 [142477] (1 species) Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142478] (1 PDB entry)
Uniprot Q97NB0 1-114! Uniprot Q97NB0 115-289
Domain d2gupa1: 2gup A:1-114 [135744]
complexed with suc, trs
Details for d2gupa1
PDB Entry: 2gup (more details), 2.01 Å
PDB Description: structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
PDB Compounds: (A:) ROK family proteinSCOPe Domain Sequences for d2gupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtiatidiggtgikfasltpdgkildktsistpenledllawldqrlseqdysgiamsvp
gavnqetgvidgfsavpyihgfswyealssyqlpvhlendancvglsellahpe
SCOPe Domain Coordinates for d2gupa1:
Click to download the PDB-style file with coordinates for d2gupa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gupa1:
- d2gupa1 first appeared in SCOP 1.73
- d2gupa1 appears in SCOPe 2.04
- d2gupa1 appears in SCOPe 2.06
- d2gupa1 appears in the current release, SCOPe 2.08
View in 3D
