Lineage for d2guka1 (2guk A:4-114)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011554Fold d.360: PG1857-like [160447] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha(3); 3 layers, a/b/a; antiparallel beta-sheet, order: 132
  4. 3011555Superfamily d.360.1: PG1857-like [160448] (1 family) (S)
    automatically mapped to Pfam PF09633
  5. 3011556Family d.360.1.1: PG1857-like [160449] (1 protein)
    Pfam PF09633; DUF2023
  6. 3011557Protein Hypothetical protein PG1857 [160450] (1 species)
  7. 3011558Species Porphyromonas gingivalis [TaxId:837] [160451] (1 PDB entry)
    Uniprot Q7MTT4 4-114
  8. 3011559Domain d2guka1: 2guk A:4-114 [147182]

Details for d2guka1

PDB Entry: 2guk (more details), 1.91 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function from Porphyromonas gingivalis
PDB Compounds: (A:) hypothetical protein PG1857

SCOPe Domain Sequences for d2guka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guka1 d.360.1.1 (A:4-114) Hypothetical protein PG1857 {Porphyromonas gingivalis [TaxId: 837]}
qtlnsdlrvfmhhiyefekgvrsmvlatlanddipyaeerlrsrqipyfaqptpntertn
lffgckecmeairlfvsgrslnsltpeedfiigamlgydicrqcerycrrk

SCOPe Domain Coordinates for d2guka1:

Click to download the PDB-style file with coordinates for d2guka1.
(The format of our PDB-style files is described here.)

Timeline for d2guka1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gukb_