Lineage for d2gtya1 (2gty A:1-121)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.77: beta-Prism I [51091] (4 superfamilies)
consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
duplication: has internal pseudo threefold symmetrySuperfamily b.77.3: Mannose-binding lectins [51101] (2 families) 
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) Protein Griffithsin [141569] (2 species)
single-chain subunits form a segment-swapped dimerSpecies Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
Uniprot P84801 1-121
Domain d2gtya1: 2gty A:1-121 [135713]
complexed with edo, so4
Details for d2gtya1
PDB Entry: 2gty (more details), 1.3 Å
PDB Description: Crystal structure of unliganded griffithsin
PDB Compounds: (A:) GriffithsinSCOPe Domain Sequences for d2gtya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtya1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y
SCOPe Domain Coordinates for d2gtya1:
Click to download the PDB-style file with coordinates for d2gtya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gtya1:
- d2gtya1 first appeared in SCOP 1.73
- d2gtya1 appears in SCOPe 2.07
View in 3D
