Lineage for d2gtga1 (2gtg A:2-79)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771691Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 771692Superfamily a.64.1: Saposin [47862] (4 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 771693Family a.64.1.1: NKL-like [47863] (3 proteins)
  6. 771700Protein Saposin C [89077] (1 species)
  7. 771701Species Human (Homo sapiens) [TaxId:9606] [89078] (5 PDB entries)
  8. 771702Domain d2gtga1: 2gtg A:2-79 [135649]
    automatically matched to d1m12a_

Details for d2gtga1

PDB Entry: 2gtg (more details), 2.4 Å

PDB Description: Crystal Structure of Human Saposin C
PDB Compounds: (A:) Proactivator polypeptide

SCOP Domain Sequences for d2gtga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi
lleevspelvcsmlhlcs

SCOP Domain Coordinates for d2gtga1:

Click to download the PDB-style file with coordinates for d2gtga1.
(The format of our PDB-style files is described here.)

Timeline for d2gtga1: