Class a: All alpha proteins [46456] (284 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (4 families) Lipid-binding can promote conformational changes and oligomerisation in some members |
Family a.64.1.1: NKL-like [47863] (3 proteins) |
Protein Saposin C [89077] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89078] (5 PDB entries) |
Domain d2gtga1: 2gtg A:2-79 [135649] automatically matched to d1m12a_ |
PDB Entry: 2gtg (more details), 2.4 Å
SCOP Domain Sequences for d2gtga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} dvycevceflvkevtklidnnktekeildafdkmcsklpkslseecqevvdtygssilsi lleevspelvcsmlhlcs
Timeline for d2gtga1: