![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.9: Birnaviridae-like VP [141109] (2 proteins) dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses; includes Pfam PF01766; Birnavirus VP2 protein |
![]() | Protein Birnavirus VP2 [141110] (1 species) Link between +sRNA and dsRNA viruses two domains - the first similar to (88633) and the second, insert domain is similar to (49818). dsRNA virus but unlike the other dsRNA viruses has a genomic arrangement and genomic replication strategy similar to +sRNA viruses |
![]() | Species Infectious bursal disease virus [TaxId:10995] [141111] (3 PDB entries) Uniprot P15480 11-431! Uniprot P61825 8-440! Uniprot Q6S9I7 11-429 |
![]() | Domain d2gsya1: 2gsy A:8-440 [135599] Other proteins in same PDB: d2gsyb_, d2gsyc_, d2gsyd_, d2gsye_, d2gsyf_, d2gsyg_, d2gsyh_, d2gsyi_, d2gsyj_, d2gsyk_, d2gsyl_, d2gsym_, d2gsyn_, d2gsyo_, d2gsyp_, d2gsyq_, d2gsyr_, d2gsys_, d2gsyt_ complexed with ca |
PDB Entry: 2gsy (more details), 2.6 Å
SCOPe Domain Sequences for d2gsya1:
Sequence, based on SEQRES records: (download)
>d2gsya1 b.121.4.9 (A:8-440) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinav tfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipai gldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelv frtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpits ikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvag vsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfm evadlnsplkiag
>d2gsya1 b.121.4.9 (A:8-440) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevadl nsplkiag
Timeline for d2gsya1: