Lineage for d2gs4a1 (2gs4 A:3-161)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.4: YciF-like [140445] (3 proteins)
Pfam PF05974; DUF892
Protein Hypothetical protein YciF [140448] (1 species) Species Escherichia coli [TaxId:562] [140449] (1 PDB entry)
Uniprot P21362 3-161
Domain d2gs4a1: 2gs4 A:3-161 [135575]
Details for d2gs4a1
PDB Entry: 2gs4 (more details), 2 Å
PDB Description: The crystal structure of the E.coli stress protein YciF.
PDB Compounds: (A:) Protein yciFSCOPe Domain Sequences for d2gs4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gs4a1 a.25.1.4 (A:3-161) Hypothetical protein YciF {Escherichia coli [TaxId: 562]}
mktiedvfihllsdtysaekqltralaklaratsneklsqafhahleethgqieridqvv
esesnlkikrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtlat
laeqlgyrkaakllketleeekatdikltdlainnvnkk
SCOPe Domain Coordinates for d2gs4a1:
Click to download the PDB-style file with coordinates for d2gs4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gs4a1:
- d2gs4a1 first appeared in SCOP 1.73
- d2gs4a1 appears in SCOPe 2.07
View in 3D
