Lineage for d2grra_ (2grr A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries)
identical sequence in many other species
Domain d2grra_: 2grr A: [161441]
Other proteins in same PDB: d2grrb_
automated match to d1u9aa_
Details for d2grra_
PDB Entry: 2grr (more details), 1.3 Å
PDB Description: crystal structure of human rangap1-ubc9-d127s
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 ISCOPe Domain Sequences for d2grra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grra_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell
nepniqspaqaeaytiycqnrveyekrvraqakkfap
SCOPe Domain Coordinates for d2grra_:
Click to download the PDB-style file with coordinates for d2grra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2grra_:
- d2grra_ first appeared in SCOPe 2.01
- d2grra_ appears in SCOPe 2.05
- d2grra_ appears in SCOPe 2.07
- d2grra_ appears in the current release, SCOPe 2.08
View in 3D
