Lineage for d2grnb1 (2grn B:431-587)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) 
automatically mapped to Pfam PF07834Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
Uniprot P46060 431-587! Uniprot P46060 432-587
Domain d2grnb1: 2grn B:431-587 [145220]
Other proteins in same PDB: d2grna_
Details for d2grnb1
PDB Entry: 2grn (more details), 1.8 Å
PDB Description: crystal structure of human rangap1-ubc9
PDB Compounds: (B:) ran gtpase-activating protein 1SCOPe Domain Sequences for d2grnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grnb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv
SCOPe Domain Coordinates for d2grnb1:
Click to download the PDB-style file with coordinates for d2grnb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2grnb1:
- d2grnb1 first appeared in SCOP 1.75
- d2grnb1 appears in SCOPe 2.02
- d2grnb1 appears in SCOPe 2.04
- d2grnb1 appears in the current release, SCOPe 2.08
View in 3D
