Lineage for d2gpfa1 (2gpf A:1-72)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573862Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2573926Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2573927Family d.100.2.1: MbtH-like [160583] (2 proteins)
    Pfam PF03621
  6. 2573928Protein Uncharacterized protein PA2412 [160584] (2 species)
  7. 2573931Species Pseudomonas aeruginosa [TaxId:287] [160585] (1 PDB entry)
    Uniprot Q9I169 1-72
  8. 2573932Domain d2gpfa1: 2gpf A:1-72 [147153]

Details for d2gpfa1

PDB Entry: 2gpf (more details)

PDB Description: solution nmr structure of protein pa22412 from pseudomonas aeruginosa. northeast structural genomics consortium target pat86, ontario centre for structural proteomics target pa2412.
PDB Compounds: (A:) conserved hypothetical protein PA2412

SCOPe Domain Sequences for d2gpfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpfa1 d.100.2.1 (A:1-72) Uncharacterized protein PA2412 {Pseudomonas aeruginosa [TaxId: 287]}
mtsvfdrddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdmrp
lslrqhmdkaag

SCOPe Domain Coordinates for d2gpfa1:

Click to download the PDB-style file with coordinates for d2gpfa1.
(The format of our PDB-style files is described here.)

Timeline for d2gpfa1: