Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47290] (8 PDB entries) |
Domain d2gmfa_: 2gmf A: [16849] |
PDB Entry: 2gmf (more details), 2.4 Å
SCOPe Domain Sequences for d2gmfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmfa_ a.26.1.2 (A:) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} rspspstqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelyk qglrgsltklkgpltmmashykqhcpptpetscatqiitfesfkenlkdfllvipfdcwe p
Timeline for d2gmfa_: