Lineage for d2glvl_ (2glv L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944056Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2944057Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2944058Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries)
  8. 2944160Domain d2glvl_: 2glv L: [193887]
    automated match to d3dp3a_
    complexed with cl; mutant

Details for d2glvl_

PDB Entry: 2glv (more details), 2.5 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase(fabz) mutant(y100a) from helicobacter pylori
PDB Compounds: (L:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d2glvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glvl_ d.38.1.6 (L:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivafmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaere

SCOPe Domain Coordinates for d2glvl_:

Click to download the PDB-style file with coordinates for d2glvl_.
(The format of our PDB-style files is described here.)

Timeline for d2glvl_: