Lineage for d2gkea2 (2gke A:131-274)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein)
automatically mapped to Pfam PF01678Protein Diaminopimelate epimerase [54508] (2 species) Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries) 
Domain d2gkea2: 2gke A:131-274 [135330]
automated match to d1gqza2
complexed with acy, gol, zdp
Details for d2gkea2
PDB Entry: 2gke (more details), 1.35 Å
PDB Description: Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor LL-AziDAP
PDB Compounds: (A:) Diaminopimelate epimeraseSCOPe Domain Sequences for d2gkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkea2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl
SCOPe Domain Coordinates for d2gkea2:
Click to download the PDB-style file with coordinates for d2gkea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gkea2:
- d2gkea2 first appeared in SCOP 1.73
- d2gkea2 appears in SCOPe 2.03
- d2gkea2 appears in SCOPe 2.05
- d2gkea2 appears in the current release, SCOPe 2.08
View in 3D
