Lineage for d2gjsa1 (2gjs A:91-258)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rad [142295] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142296] (1 PDB entry)
Uniprot P55042 91-258
Domain d2gjsa1: 2gjs A:91-258 [135287]
Other proteins in same PDB: d2gjsb_
complexed with gdp, mg
Details for d2gjsa1
PDB Entry: 2gjs (more details), 1.9 Å
PDB Description: The crystal structure of human RRAD in complex with GDP
PDB Compounds: (A:) GTP-binding protein RADSCOPe Domain Sequences for d2gjsa1:
Sequence, based on SEQRES records: (download)
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvedgpeaeaaghtydrsivvdgeeaslmvydiweqdg
grwlpghcmamgdayvivysvtdkgsfekaselrvqlrrarqtddvpiilvgnksdlvrs
revsvdegracavvfdckfietsaalhhnvqalfegvvrqirlrrdsk
Sequence, based on observed residues (ATOM records): (download)
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}
vykvlllgapgvgksalarifggvghtydrsivvdgeeaslmvydiwlpghcmamgdayv
ivysvtdkgsfekaselrvqlrrarqdvpiilvgnksdlvrsrevsvdegracavvfdck
fietsaalhhnvqalfegvvrqirlrrdsk
SCOPe Domain Coordinates for d2gjsa1:
Click to download the PDB-style file with coordinates for d2gjsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gjsa1:
- d2gjsa1 first appeared in SCOP 1.73
- d2gjsa1 appears in SCOPe 2.03
- d2gjsa1 appears in SCOPe 2.05
- d2gjsa1 appears in the current release, SCOPe 2.08
View in 3D
