Lineage for d2gixd_ (2gix D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770929Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 1770947Protein automated matches [190782] (2 species)
    not a true protein
  7. 1770954Species Mouse (Mus musculus) [TaxId:10090] [188028] (9 PDB entries)
  8. 1770958Domain d2gixd_: 2gix D: [193865]
    automated match to d2e4fa_
    complexed with k, mpd; mutant

Details for d2gixd_

PDB Entry: 2gix (more details), 2.02 Å

PDB Description: cytoplasmic domain structure of kir2.1 containing andersen's mutation r218q and rescue mutation t309k
PDB Compounds: (D:) Inward rectifier potassium channel 2

SCOPe Domain Sequences for d2gixd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gixd_ b.1.18.16 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shgrsrfvkkdghcnvqfinvgekrnetlvfshnaviamrdgklclmwrvgnlqkshlve
ahvraqllksritsegeyipldqidinvgfdsgidriflvspitivheidedsplydlsk
qdidnadfeivvilegmveatamtkqcrssylaneilwghryepvlfeekhyykvdysrf
hktyevpntplcsardlaekkyils

SCOPe Domain Coordinates for d2gixd_:

Click to download the PDB-style file with coordinates for d2gixd_.
(The format of our PDB-style files is described here.)

Timeline for d2gixd_: