Lineage for d2ghaa_ (2gha A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523620Species Thermotoga maritima [TaxId:243274] [187721] (11 PDB entries)
  8. 2523627Domain d2ghaa_: 2gha A: [164693]
    automated match to d1anfa_
    complexed with mlr

Details for d2ghaa_

PDB Entry: 2gha (more details), 1.6 Å

PDB Description: thermotoga maritima maltotriose binding protein bound with maltotriose
PDB Compounds: (A:) maltose ABC transporter, periplasmic maltose-binding protein

SCOPe Domain Sequences for d2ghaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghaa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiiv
gahdwvgelavngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyv
peppktmdelieiakqideefggevrgfitsaaefyyiapfifgyggyvfkqtekgldvn
diglanegaikgvkllkrlvdegildpsdnyqimdsmfregqaamiingpwaikaykdag
idygvapipdlepgvparpfvgvqgfmvnakspnkllaiefltsfiakketmyriylgdp
rlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamndalnlvvngkatvee
alknaverikaqiq

SCOPe Domain Coordinates for d2ghaa_:

Click to download the PDB-style file with coordinates for d2ghaa_.
(The format of our PDB-style files is described here.)

Timeline for d2ghaa_: