Lineage for d2gh1a1 (2gh1 A:13-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894247Family c.66.1.49: BC2162-like [142629] (2 proteins)
    contains extra helical regions inserted after strands 5 and 6 of the canonical fold
  6. 2894248Protein Methyltransferase BC2162 [142630] (1 species)
  7. 2894249Species Bacillus cereus [TaxId:1396] [142631] (1 PDB entry)
    Uniprot Q81E32 13-293
  8. 2894250Domain d2gh1a1: 2gh1 A:13-293 [135170]
    complexed with act, gol

Details for d2gh1a1

PDB Entry: 2gh1 (more details), 2.5 Å

PDB Description: crystal structure of the putative sam-dependent methyltransferase bc2162 from bacillus cereus, northeast structural genomics target bcr20.
PDB Compounds: (A:) Methyltransferase

SCOPe Domain Sequences for d2gh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}
ylkntrdlyynddyvsflvntvwkitkpvhivdygcgygylglvlmpllpegskytgids
getllaearelfrllpydseflegdateielndkydiaichafllhmttpetmlqkmihs
vkkggkiicfephwisnmasylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipi
ylselgvkniecrvsdkvnfldsnmhhndkndlyqslkeegiagdpgdkqqfverliarg
ltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec

SCOPe Domain Coordinates for d2gh1a1:

Click to download the PDB-style file with coordinates for d2gh1a1.
(The format of our PDB-style files is described here.)

Timeline for d2gh1a1: