Lineage for d2gh0d_ (2gh0 D:)
- Root: SCOPe 2.05
Class g: Small proteins [56992] (92 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
disulfide-rich fold; common core is all-betaSuperfamily g.17.1: Cystine-knot cytokines [57501] (8 families) 
Family g.17.1.0: automated matches [191392] (1 protein)
not a true familyProtein automated matches [190506] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187459] (17 PDB entries) 
Domain d2gh0d_: 2gh0 D: [164691]
automated match to d1agqa_
complexed with nag
Details for d2gh0d_
PDB Entry: 2gh0 (more details), 1.92 Å
PDB Description: growth factor/receptor complex
PDB Compounds: (D:) arteminSCOPe Domain Sequences for d2gh0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gh0d_ g.17.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgs
rpvsqpccrptryeavsfmdvnstwrtvdrlsatacgcl
SCOPe Domain Coordinates for d2gh0d_:
Click to download the PDB-style file with coordinates for d2gh0d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gh0d_:
- d2gh0d_ first appeared in SCOPe 2.01
- d2gh0d_ appears in SCOPe 2.04
- d2gh0d_ is called d2gh0d1 in SCOPe 2.06
- d2gh0d_ appears in the current release, SCOPe 2.08, called d2gh0d1
View in 3D
