Lineage for d2ggca_ (2ggc A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214036Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2214037Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2214038Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2214087Protein Methionine aminopeptidase [55924] (6 species)
  7. 2214088Species Escherichia coli K-12 [TaxId:83333] [187115] (9 PDB entries)
  8. 2214089Domain d2ggca_: 2ggc A: [135127]
    automated match to d1mat__
    complexed with co, met, na

Details for d2ggca_

PDB Entry: 2ggc (more details), 1 Å

PDB Description: Novel bacterial methionine aminopeptidase inhibitors
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2ggca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggca_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli K-12 [TaxId: 83333]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2ggca_:

Click to download the PDB-style file with coordinates for d2ggca_.
(The format of our PDB-style files is described here.)

Timeline for d2ggca_: