Lineage for d2gfaa2 (2gfa A:897-955)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394118Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. 2394119Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
    Uniprot O75164 897-955! Uniprot O75164 956-1011
  8. 2394125Domain d2gfaa2: 2gfa A:897-955 [135090]
    automatically matched to 2GF7 A:897-955

Details for d2gfaa2

PDB Entry: 2gfa (more details), 2.1 Å

PDB Description: double tudor domain complex structure
PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gfaa2:

Sequence, based on SEQRES records: (download)

>d2gfaa2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

Sequence, based on observed residues (ATOM records): (download)

>d2gfaa2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivg

SCOPe Domain Coordinates for d2gfaa2:

Click to download the PDB-style file with coordinates for d2gfaa2.
(The format of our PDB-style files is described here.)

Timeline for d2gfaa2:

2394125
d2gfaa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2gfaa1