Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries) |
Domain d2gf9a_: 2gf9 A: [164676] automated match to d1zbda_ complexed with gdp, mg, unx |
PDB Entry: 2gf9 (more details), 1.53 Å
SCOPe Domain Sequences for d2gf9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf9a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvprgsdymfklllignssvgktsflfryaddsftpafvstvgidfkvktvyrhdkrikl qiwdtagqeryrtittayyrgamgfllmydianqesfaavqdwatqiktyswdnaqvilv gnkcdledervvpaedgrrladdlgfeffeasakeninvkqvferlvdvicekmne
Timeline for d2gf9a_: