Lineage for d2gf7a2 (2gf7 A:897-955)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. Protein Jumonji domain-containing protein 2A [141203] (1 species)
    contains tandem repeat of two segment-swapped Tudor domains
  7. Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
    Uniprot O75164 897-955! Uniprot O75164 956-1011
  8. Domain d2gf7a2: 2gf7 A:897-955 [135082]
    complexed with so4

Details for d2gf7a2

PDB Entry: 2gf7 (more details), 2.2 Å

PDB Description: double tudor domain structure
PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gf7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf7a2 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
qsitagqkviskhkngrfyqcevvrlttetfyevnfddgsfsdnlypedivsqdclqfg

SCOPe Domain Coordinates for d2gf7a2 are not available.

Timeline for d2gf7a2:

Domains from same chain:
(mouse over for more information)
d2gf7a1
Domains from other chains:
(mouse over for more information)
d2gf7b1, d2gf7b2, d2gf7c1, d2gf7c2, d2gf7d1, d2gf7d2