SCOPe 2.08: Domain d2gf7a1: 2gf7 A:956-1011

Lineage for d2gf7a1 (2gf7 A:956-1011)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)
Family b.34.9.1: Tudor domain [63749] (9 proteins)
Pfam PF00567
Protein Jumonji domain-containing protein 2A [141203] (1 species)
contains tandem repeat of two segment-swapped Tudor domains
Species Human (Homo sapiens) [TaxId:9606] [141204] (4 PDB entries)
Uniprot O75164 897-955! Uniprot O75164 956-1011
Domain d2gf7a1: 2gf7 A:956-1011 [135081]
complexed with so4

Details for d2gf7a1

PDB Entry: 2gf7 (more details), 2.2 Å

PDB Description: double tudor domain structure

PDB Compounds: (A:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf7a1 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]}
ppaegevvqvrwtdgqvygakfvashpiqmyqvefedgsqlvvkrddvytldeelp

SCOPe Domain Coordinates for d2gf7a1:

Click to download the PDB-style file with coordinates for d2gf7a1.
(The format of our PDB-style files is described here.)

Timeline for d2gf7a1: