Lineage for d2gf0a1 (2gf0 A:4-176)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein di-Ras1 [142277] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry)
    Uniprot O95057 4-176
  8. Domain d2gf0a1: 2gf0 A:4-176 [135066]
    complexed with gdp, mg

Details for d2gf0a1

PDB Entry: 2gf0 (more details), 1.9 Å

PDB Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
PDB Compounds: (A:) GTP-binding protein Di-Ras1

SCOPe Domain Sequences for d2gf0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf0a1 c.37.1.8 (A:4-176) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]}
qsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdtt
gshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkc
detqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln

SCOPe Domain Coordinates for d2gf0a1 are not available.

Timeline for d2gf0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gf0b_, d2gf0c_, d2gf0d_