Lineage for d2gexa1 (2gex A:2-139)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheetSuperfamily d.17.4: NTF2-like [54427] (31 families) 
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) 
Protein Nogalamycin biosynthesis protein SnoL [159967] (1 species) Species Streptomyces nogalater [TaxId:38314] [159968] (1 PDB entry)
Uniprot Q9RN64 2-139
Domain d2gexa1: 2gex A:2-139 [147112]
Other proteins in same PDB: d2gexa2
Details for d2gexa1
PDB Entry: 2gex (more details), 2.5 Å
PDB Description: Crystal structure of SnoaL2 a putative hydroxylase from Streptomyces nogalater
PDB Compounds: (A:) SnoLSCOPe Domain Sequences for d2gexa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}
sttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafpd
lrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehwd
vfnfsplfrdlgvvpdgl
SCOPe Domain Coordinates for d2gexa1:
Click to download the PDB-style file with coordinates for d2gexa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gexa1:
- d2gexa1 first appeared in SCOP 1.75
- d2gexa1 appears in SCOPe 2.07
View in 3D
