Lineage for d2ge3a1 (2ge3 A:6-169)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Probable acetyltransferase Atu2290 [143660] (1 species)
  7. Species Agrobacterium tumefaciens [TaxId:358] [143661] (1 PDB entry)
    Uniprot Q8UD38 6-169
  8. Domain d2ge3a1: 2ge3 A:6-169 [135044]
    Other proteins in same PDB: d2ge3b_, d2ge3c_, d2ge3d_
    complexed with aco

Details for d2ge3a1

PDB Entry: 2ge3 (more details), 2.25 Å

PDB Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
PDB Compounds: (A:) Probable acetyltransferase

SCOPe Domain Sequences for d2ge3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}
dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia
dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels
vhadnaraialyekigfahegrardavsidghyidslnmaiifg

SCOPe Domain Coordinates for d2ge3a1 are not available.

Timeline for d2ge3a1:

Domains from other chains:
(mouse over for more information)
d2ge3b_, d2ge3c_, d2ge3d_