![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
![]() | Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
![]() | Species Bacillus brevis [TaxId:1393] [47344] (6 PDB entries) |
![]() | Domain d2gdwa_: 2gdw A: [135040] automated match to d2gdwa1 |
PDB Entry: 2gdw (more details)
SCOPe Domain Sequences for d2gdwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdwa_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq velplkvlfaqptikalaqyvatrs
Timeline for d2gdwa_: