Lineage for d2gcob_ (2gco B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595245Protein RhoC [142245] (1 species)
  7. 1595246Species Human (Homo sapiens) [TaxId:9606] [142246] (3 PDB entries)
    Uniprot P08134 1-179
  8. 1595248Domain d2gcob_: 2gco B: [204335]
    automated match to d2wm9b_
    complexed with gnp, mg

Details for d2gcob_

PDB Entry: 2gco (more details), 1.4 Å

PDB Description: Crystal structure of the human RhoC-GppNHp complex
PDB Compounds: (B:) Rho-related GTP-binding protein RhoC

SCOPe Domain Sequences for d2gcob_:

Sequence, based on SEQRES records: (download)

>d2gcob_ c.37.1.8 (B:) RhoC {Human (Homo sapiens) [TaxId: 9606]}
hhssglvprgshmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyiadiev
dgkqvelalwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcp
nvpiilvgnkkdlrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvr
evfematraglq

Sequence, based on observed residues (ATOM records): (download)

>d2gcob_ c.37.1.8 (B:) RhoC {Human (Homo sapiens) [TaxId: 9606]}
hhssglvpirkklvivgdgacgktcllivfskdqfpvptvfenyiadievdgkqvelalw
dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
kdlrqdehtrrelakmkqepvrseegrdmanrisafgylecsaktkegvrevfematrag
lq

SCOPe Domain Coordinates for d2gcob_:

Click to download the PDB-style file with coordinates for d2gcob_.
(The format of our PDB-style files is described here.)

Timeline for d2gcob_: