![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.10: SSRP1-like [141436] (2 proteins) Pfam PF03531; Structure-specific recognition protein family; duplication: comprises tandem repeat of two domains of this fold |
![]() | Protein FACT complex subunit POB3, middle domain [141437] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141438] (2 PDB entries) Uniprot Q04636 237-474! Uniprot Q04636 238-474 |
![]() | Domain d2gcja1: 2gcj A:238-474 [134987] |
PDB Entry: 2gcj (more details), 2.55 Å
SCOPe Domain Sequences for d2gcja1:
Sequence, based on SEQRES records: (download)
>d2gcja1 b.55.1.10 (A:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisragqtstssrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
>d2gcja1 b.55.1.10 (A:238-474) FACT complex subunit POB3, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agdaivsfqdvffttprgrydidiyknsirlrgktyeyklqhrqiqrivslpkaddihhl lvlaiepplrkgqttypflvlqfqkdeetevqlnlededyeenykdklkkqydakthivl shvlkgltdrrvivpgeykskydqcavscsfkanegylypldnafffltkptlyipfsdv smvnisrrtfdlevvlrsnrgsttfaniskeeqqlleqflksknlrvkn
Timeline for d2gcja1: