Lineage for d2g9nb_ (2g9n B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597279Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 1597350Protein Initiation factor 4a [52706] (2 species)
    homologous to UvrB
  7. 1597358Species Human (Homo sapiens) [TaxId:9606] [142305] (2 PDB entries)
    Uniprot P60842 21-238
    4A-I
  8. 1597360Domain d2g9nb_: 2g9n B: [134815]
    automated match to d1fuua_

Details for d2g9nb_

PDB Entry: 2g9n (more details), 2.25 Å

PDB Description: Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
PDB Compounds: (B:) Eukaryotic initiation factor 4A-I

SCOPe Domain Sequences for d2g9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9nb_ c.37.1.19 (B:) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
iesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgtgk
tatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnvra
evqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydifqk
lnsntqvvllsatmpsdvlevtkkfmrdpirilvk

SCOPe Domain Coordinates for d2g9nb_:

Click to download the PDB-style file with coordinates for d2g9nb_.
(The format of our PDB-style files is described here.)

Timeline for d2g9nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2g9na1