![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.340: CofE-like [144009] (1 superfamily) consists of two different domains; d1: beta-alpha-beta-alpha-beta(2)-alpha-beta, mixed sheet of 5 strands, order:15234, strands 2 and 3 are parralel; d2 is inserted in d1 after strand 2 and comprises a helix-turn-helix motif and two 3-stranded sheets |
![]() | Superfamily d.340.1: CofE-like [144010] (1 family) ![]() automatically mapped to Pfam PF01996 |
![]() | Family d.340.1.1: CofE-like [144011] (1 protein) Pfam PF01996; DUF129; contains known activity |
![]() | Protein F420-0:gamma-glutamyl ligase CofE [144012] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [144013] (2 PDB entries) Uniprot O28028 1-249 |
![]() | Domain d2g9ia1: 2g9i A:1-249 [134806] |
PDB Entry: 2g9i (more details), 2.5 Å
SCOPe Domain Sequences for d2g9ia1:
Sequence, based on SEQRES records: (download)
>d2g9ia1 d.340.1.1 (A:1-249) F420-0:gamma-glutamyl ligase CofE {Archaeoglobus fulgidus [TaxId: 2234]} mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrk dlygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedv irrclkrcl
>d2g9ia1 d.340.1.1 (A:1-249) F420-0:gamma-glutamyl ligase CofE {Archaeoglobus fulgidus [TaxId: 2234]} mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwvtve cvadeiaafanllmggipavvvrglnvagegsmeeiyrseeedvirrclkrcl
Timeline for d2g9ia1: