Lineage for d2g8ma_ (2g8m A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) 
automatically mapped to Pfam PF00303Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) 
Protein Thymidylate synthase [55833] (7 species) Species Escherichia coli [TaxId:562] [55834] (70 PDB entries) 
Domain d2g8ma_: 2g8m A: [303922]
automated match to d4geva_
complexed with cb3, ump
Details for d2g8ma_
PDB Entry: 2g8m (more details), 1.3 Å
PDB Description: Escherichia coli thymidylate synthase Y209W in complex with substrate, dUMP, and a cofactor analog, CB3717
PDB Compounds: (A:) Thymidylate synthaseSCOPe Domain Sequences for d2g8ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8ma_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlwsnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOPe Domain Coordinates for d2g8ma_:
Click to download the PDB-style file with coordinates for d2g8ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g8ma_:
- d2g8ma_ first appeared in SCOPe 2.06
- d2g8ma_ appears in SCOPe 2.07
View in 3D
