Lineage for d2g84b_ (2g84 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (6 families) 
contains extra C-terminal strand 5, order 21345Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
strand 5 is parallel to strand 4
Protein Putative deaminase NE0047 [142833] (1 species) Species Nitrosomonas europaea [TaxId:915] [142834] (9 PDB entries)
Uniprot Q82Y41 1-189
Domain d2g84b_: 2g84 B: [161428]
automated match to d2g84a1
complexed with bme, edo, na, zn
Details for d2g84b_
PDB Entry: 2g84 (more details), 1.4 Å
PDB Description: cytidine and deoxycytidylate deaminase zinc-binding region from nitrosomonas europaea.
PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding regionSCOPe Domain Sequences for d2g84b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g84b_ c.97.1.2 (B:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
ac
SCOPe Domain Coordinates for d2g84b_:
Click to download the PDB-style file with coordinates for d2g84b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g84b_:
- d2g84b_ first appeared in SCOPe 2.01
- d2g84b_ appears in SCOPe 2.04
- d2g84b_ is called d2g84b1 in SCOPe 2.06
- d2g84b_ appears in the current release, SCOPe 2.08, called d2g84b1
View in 3D
