| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.241: TraM-like [140580] (1 superfamily) multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices |
Superfamily a.241.1: TraM-like [140581] (1 family) ![]() automatically mapped to Pfam PF05261 |
| Family a.241.1.1: TraM-like [140582] (1 protein) Pfam PF05261 |
| Protein TraM [140583] (2 species) also includes the N-terminal domain structure 1dp3, previously classified into a different family (63566) |
| Species Escherichia coli [TaxId:562] [140584] (2 PDB entries) Uniprot P10026 50-127! Uniprot P10026 60-167 |
| Domain d2g7oa1: 2g7o A:60-127 [134736] |
PDB Entry: 2g7o (more details), 1.4 Å
SCOPe Domain Sequences for d2g7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7oa1 a.241.1.1 (A:60-127) TraM {Escherichia coli [TaxId: 562]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffpkndde
Timeline for d2g7oa1: