Lineage for d2g6fx_ (2g6f X:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783781Protein automated matches [190043] (6 species)
    not a true protein
  7. 1783846Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)
  8. 1783847Domain d2g6fx_: 2g6f X: [204299]
    automated match to d2p4ra_
    complexed with nco

Details for d2g6fx_

PDB Entry: 2g6f (more details), 0.92 Å

PDB Description: Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
PDB Compounds: (X:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d2g6fx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6fx_ b.34.2.1 (X:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gplgsvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei

SCOPe Domain Coordinates for d2g6fx_:

Click to download the PDB-style file with coordinates for d2g6fx_.
(The format of our PDB-style files is described here.)

Timeline for d2g6fx_: