Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
Protein Sentrin-specific protease 1 [142862] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142863] (6 PDB entries) Uniprot Q9P0U3 419-643 |
Domain d2g4da1: 2g4d A:440-643 [145184] Other proteins in same PDB: d2g4db1, d2g4dd1 mutant |
PDB Entry: 2g4d (more details), 2.8 Å
SCOPe Domain Sequences for d2g4da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4da1 d.3.1.7 (A:440-643) Sentrin-specific protease 1 {Human (Homo sapiens) [TaxId: 9606]} qdevlseafrltitrkdiqtlnhlnwlndeiinfymnmlmerskekglpsvhafntffft klktagyqavkrwtkkvdvfsvdillvpihlgvhwclavvdfrkknityydsmgginnea crillqylkqesidkkrkefdtngwqlfskksqeipqqmngsdsgmfackyadcitkdrp inftqqhmpyfrkrmvweilhrkl
Timeline for d2g4da1: