Lineage for d2g3wa1 (2g3w A:4-182)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1372032Family c.52.1.33: YaeQ-like [159605] (2 proteins)
    Pfam PF07152; contains extra N- and C-terminal beta-structures forming additional five-stranded beta-sheet; retains the PD motif in the putative active site
  6. 1372036Protein Hypothetical protein XAC2396 [159606] (1 species)
  7. 1372037Species Xanthomonas axonopodis pv. citri [TaxId:92829] [159607] (1 PDB entry)
    Uniprot Q8PJY1 4-182
  8. 1372038Domain d2g3wa1: 2g3w A:4-182 [147077]
    complexed with act

Details for d2g3wa1

PDB Entry: 2g3w (more details), 1.9 Å

PDB Description: The Crystal Structure of YaeQ Protein from Xanthomonas axonopodis pv. citri
PDB Compounds: (A:) hypothetical protein XAC2396

SCOPe Domain Sequences for d2g3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3wa1 c.52.1.33 (A:4-182) Hypothetical protein XAC2396 {Xanthomonas axonopodis pv. citri [TaxId: 92829]}
tatvrraelqisdmdrgyyanhsltlaqhpsetderlmvrllafalfaddrlefgrglsn
ddepdlwrrdytgdpdlwidlgqpdesrvrkacnrsreavvigyggqatetwwkkhanam
gryrnlrvieldsqatealgaliqrgmrfdviiqdgevqmladhgsvtltpmvrqapae

SCOPe Domain Coordinates for d2g3wa1:

Click to download the PDB-style file with coordinates for d2g3wa1.
(The format of our PDB-style files is described here.)

Timeline for d2g3wa1: