Lineage for d2g39a2 (2g39 A:224-497)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) 
Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
parallel beta-sheet of 7 strands, order 4321567
Protein Acetyl-CoA hydrolase (PA5445) [142196] (1 species)
duplication: consists of two topologically similar domains; overall similarity to CitF2Species Pseudomonas aeruginosa [TaxId:287] [142197] (1 PDB entry)
Uniprot Q9HTC2 224-497! Uniprot Q9HTC2 3-223
Domain d2g39a2: 2g39 A:224-497 [134554]
complexed with acy, edo
Details for d2g39a2
PDB Entry: 2g39 (more details), 2.1 Å
PDB Description: Crystal structure of coenzyme A transferase from Pseudomonas aeruginosa
PDB Compounds: (A:) Acetyl-CoA hydrolaseSCOPe Domain Sequences for d2g39a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g39a2 c.124.1.2 (A:224-497) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]}
stvlppdgetqaianhlidffkrevdagrmsnslgplqagigsianavmcgliespfenl
tmysevlqdstfdlidagklrfasgssitlsprrnadvfgnlerykdklvlrpqeisnhp
evvrrlgiigintalefdiygnvnsthvggtkmmngiggsgdfarnahlaifvtksiakg
gnissvvpmvshvdhtehdvdilvteqgladlrglaprerarviiencvhpsyqaplldy
feaacakgghtphllrealawhlnleerghmlag
SCOPe Domain Coordinates for d2g39a2:
Click to download the PDB-style file with coordinates for d2g39a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g39a2:
- d2g39a2 first appeared in SCOP 1.73
- d2g39a2 appears in SCOPe 2.07
View in 3D
