Lineage for d2g2nc_ (2g2n C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113877Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1113878Protein automated matches [190651] (6 species)
    not a true protein
  7. 1113886Species Escherichia coli [TaxId:562] [187730] (2 PDB entries)
  8. 1113889Domain d2g2nc_: 2g2n C: [164566]
    automated match to d1tfpa_
    complexed with so4, zn

Details for d2g2nc_

PDB Entry: 2g2n (more details), 1.65 Å

PDB Description: Crystal Structure of E.coli transthyretin-related protein with bound Zn
PDB Compounds: (C:) transthyretin-like protein

SCOPe Domain Sequences for d2g2nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g2nc_ b.3.4.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
qnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattgdy
rvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

SCOPe Domain Coordinates for d2g2nc_:

Click to download the PDB-style file with coordinates for d2g2nc_.
(The format of our PDB-style files is described here.)

Timeline for d2g2nc_: