Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (8 species) not a true protein |
Species Escherichia coli [TaxId:562] [187730] (2 PDB entries) |
Domain d2g2nc_: 2g2n C: [164566] automated match to d1tfpa_ complexed with so4, zn |
PDB Entry: 2g2n (more details), 1.65 Å
SCOPe Domain Sequences for d2g2nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g2nc_ b.3.4.0 (C:) automated matches {Escherichia coli [TaxId: 562]} qnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattgdy rvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs
Timeline for d2g2nc_: