Lineage for d2g1ia3 (2g1i A:361-562)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865399Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries)
  8. 2865401Domain d2g1ia3: 2g1i A:361-562 [303910]
    Other proteins in same PDB: d2g1ia2, d2g1ib2, d2g1ic2, d2g1id2
    automated match to d2vk4a3
    complexed with mg, tpp

Details for d2g1ia3

PDB Entry: 2g1i (more details), 2.26 Å

PDB Description: Crystal Structure of Pyruvate Decarboxylase from Kluyveromyces lactis
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d2g1ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g1ia3 c.36.1.0 (A:361-562) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaqltaatnak

SCOPe Domain Coordinates for d2g1ia3:

Click to download the PDB-style file with coordinates for d2g1ia3.
(The format of our PDB-style files is described here.)

Timeline for d2g1ia3: