Lineage for d2fzcb2 (2fzc B:101-153)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) 
automatically mapped to Pfam PF02748Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein) Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species) Species Escherichia coli [TaxId:562] [57828] (63 PDB entries)
Uniprot P00478
Domain d2fzcb2: 2fzc B:101-153 [134427]
Other proteins in same PDB: d2fzca1, d2fzca2, d2fzcb1, d2fzcc1, d2fzcc2, d2fzcd1
automated match to d1d09b2
complexed with ctp, eop, zn
Details for d2fzcb2
PDB Entry: 2fzc (more details), 2.1 Å
PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chainSCOPe Domain Sequences for d2fzcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fzcb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan
SCOPe Domain Coordinates for d2fzcb2:
Click to download the PDB-style file with coordinates for d2fzcb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fzcb2:
- d2fzcb2 first appeared in SCOP 1.73
- d2fzcb2 appears in SCOPe 2.06
- d2fzcb2 appears in the current release, SCOPe 2.08
View in 3D
