Lineage for d2fzcb2 (2fzc B:101-153)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464408Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1464409Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1464410Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 1464411Species Escherichia coli [TaxId:562] [57828] (59 PDB entries)
    Uniprot P00478
  8. 1464420Domain d2fzcb2: 2fzc B:101-153 [134427]
    Other proteins in same PDB: d2fzca1, d2fzca2, d2fzcb1, d2fzcc1, d2fzcc2, d2fzcd1
    automated match to d1d09b2
    complexed with ctp, eop, zn

Details for d2fzcb2

PDB Entry: 2fzc (more details), 2.1 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.10 Resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2fzcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzcb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2fzcb2:

Click to download the PDB-style file with coordinates for d2fzcb2.
(The format of our PDB-style files is described here.)

Timeline for d2fzcb2:

1464420
d2fzcb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2fzcb1