Lineage for d2fyua2 (2fyu A:234-446)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684580Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1684581Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1684610Species Cow (Bos taurus) [TaxId:9913] [55997] (17 PDB entries)
    Uniprot P31800
  8. 1684624Domain d2fyua2: 2fyu A:234-446 [134393]
    Other proteins in same PDB: d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_
    automated match to d1ntma2
    complexed with fdn, fes, hem

Details for d2fyua2

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial

SCOPe Domain Sequences for d2fyua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyua2 d.185.1.1 (A:234-446) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmfwlrf

SCOPe Domain Coordinates for d2fyua2:

Click to download the PDB-style file with coordinates for d2fyua2.
(The format of our PDB-style files is described here.)

Timeline for d2fyua2: